Notice: This page requires JavaScript to function properly.
Please enable JavaScript in your browser settings or update your browser.
Apprendre Visualizing Amino Acid Composition | Biological Data Visualization
Practice
Projects
Quizzes & Challenges
Quizzes
Challenges
/
Python for Biologists

bookVisualizing Amino Acid Composition

Visualizing the amino acid composition of protein sequences is a powerful way to understand their biochemical properties and potential functions. By plotting the frequency of each amino acid in a sequence, you can quickly spot trends such as enrichment of certain residues, which might relate to protein stability, solubility, or biological activity. Such visualizations are often the first step in exploring new proteins or comparing families of related proteins.

123456789101112131415161718
import matplotlib.pyplot as plt from collections import Counter # Example protein sequence protein_seq = "MKTFFVAGVILLLTGCFAATYAEKQKTVTAMDVVYALQ" # Count amino acid frequencies aa_counts = Counter(protein_seq) amino_acids = sorted(aa_counts.keys()) frequencies = [aa_counts[aa] for aa in amino_acids] # Plot as a bar chart plt.figure(figsize=(10,6)) plt.bar(amino_acids, frequencies, color="skyblue") plt.xlabel("Amino Acid") plt.ylabel("Frequency") plt.title("Amino Acid Composition") plt.show()
copy

Customizing the plot can make your findings more meaningful for biological interpretation. One helpful approach is to group amino acids by shared properties, such as hydrophobicity, charge, or polarity. By assigning similar colors or arranging bars by group, you can highlight patterns like an abundance of charged or hydrophobic residues, which might suggest certain functional or structural roles in the protein.

123456789101112131415161718192021222324252627282930
import matplotlib.pyplot as plt from collections import Counter # Example protein sequences protein_seqs = { "Protein A": "MKTFFVAGVILLLTGCFAATYAEKQKTVTAMDVVYALQ", "Protein B": "GAVLIWYKQKTVTAMDVVYALQGAVLIWYKQKTVTAMDVVYALQ", } amino_acids = sorted(set("".join(protein_seqs.values()))) bar_width = 0.35 x = range(len(amino_acids)) plt.figure(figsize=(12,6)) for i, (name, seq) in enumerate(protein_seqs.items()): aa_counts = Counter(seq) frequencies = [aa_counts.get(aa, 0) for aa in amino_acids] plt.bar( [xi + i * bar_width for xi in x], frequencies, width=bar_width, label=name ) plt.xlabel("Amino Acid") plt.ylabel("Frequency") plt.title("Amino Acid Composition Comparison") plt.xticks([xi + bar_width / 2 for xi in x], amino_acids) plt.legend() plt.show()
copy

1. What insights can you gain from visualizing amino acid composition?

2. Fill in the blank: To visualize amino acid composition, you need to count the frequency of each _____ in the sequence.

3. How can grouping amino acids by properties enhance your plot?

question mark

What insights can you gain from visualizing amino acid composition?

Select all correct answers

question-icon

Fill in the blank: To visualize amino acid composition, you need to count the frequency of each _____ in the sequence.

in the sequence.

Click or drag`n`drop items and fill in the blanks

question mark

How can grouping amino acids by properties enhance your plot?

Select all correct answers

Tout était clair ?

Comment pouvons-nous l'améliorer ?

Merci pour vos commentaires !

Section 3. Chapitre 4

Demandez à l'IA

expand

Demandez à l'IA

ChatGPT

Posez n'importe quelle question ou essayez l'une des questions suggérées pour commencer notre discussion

bookVisualizing Amino Acid Composition

Glissez pour afficher le menu

Visualizing the amino acid composition of protein sequences is a powerful way to understand their biochemical properties and potential functions. By plotting the frequency of each amino acid in a sequence, you can quickly spot trends such as enrichment of certain residues, which might relate to protein stability, solubility, or biological activity. Such visualizations are often the first step in exploring new proteins or comparing families of related proteins.

123456789101112131415161718
import matplotlib.pyplot as plt from collections import Counter # Example protein sequence protein_seq = "MKTFFVAGVILLLTGCFAATYAEKQKTVTAMDVVYALQ" # Count amino acid frequencies aa_counts = Counter(protein_seq) amino_acids = sorted(aa_counts.keys()) frequencies = [aa_counts[aa] for aa in amino_acids] # Plot as a bar chart plt.figure(figsize=(10,6)) plt.bar(amino_acids, frequencies, color="skyblue") plt.xlabel("Amino Acid") plt.ylabel("Frequency") plt.title("Amino Acid Composition") plt.show()
copy

Customizing the plot can make your findings more meaningful for biological interpretation. One helpful approach is to group amino acids by shared properties, such as hydrophobicity, charge, or polarity. By assigning similar colors or arranging bars by group, you can highlight patterns like an abundance of charged or hydrophobic residues, which might suggest certain functional or structural roles in the protein.

123456789101112131415161718192021222324252627282930
import matplotlib.pyplot as plt from collections import Counter # Example protein sequences protein_seqs = { "Protein A": "MKTFFVAGVILLLTGCFAATYAEKQKTVTAMDVVYALQ", "Protein B": "GAVLIWYKQKTVTAMDVVYALQGAVLIWYKQKTVTAMDVVYALQ", } amino_acids = sorted(set("".join(protein_seqs.values()))) bar_width = 0.35 x = range(len(amino_acids)) plt.figure(figsize=(12,6)) for i, (name, seq) in enumerate(protein_seqs.items()): aa_counts = Counter(seq) frequencies = [aa_counts.get(aa, 0) for aa in amino_acids] plt.bar( [xi + i * bar_width for xi in x], frequencies, width=bar_width, label=name ) plt.xlabel("Amino Acid") plt.ylabel("Frequency") plt.title("Amino Acid Composition Comparison") plt.xticks([xi + bar_width / 2 for xi in x], amino_acids) plt.legend() plt.show()
copy

1. What insights can you gain from visualizing amino acid composition?

2. Fill in the blank: To visualize amino acid composition, you need to count the frequency of each _____ in the sequence.

3. How can grouping amino acids by properties enhance your plot?

question mark

What insights can you gain from visualizing amino acid composition?

Select all correct answers

question-icon

Fill in the blank: To visualize amino acid composition, you need to count the frequency of each _____ in the sequence.

in the sequence.

Click or drag`n`drop items and fill in the blanks

question mark

How can grouping amino acids by properties enhance your plot?

Select all correct answers

Tout était clair ?

Comment pouvons-nous l'améliorer ?

Merci pour vos commentaires !

Section 3. Chapitre 4
some-alt